SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390947799|ref|YP_006411559.1| from Alistipes finegoldii DSM 17242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390947799|ref|YP_006411559.1|
Domain Number 1 Region: 108-388
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 1.53e-46
Family Lambda integrase-like, catalytic core 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|390947799|ref|YP_006411559.1|
Sequence length 404
Comment site-specific recombinase XerD [Alistipes finegoldii DSM 17242]
Sequence
MKNTFSVLFYVKKQQKKSGLLPIMGRITVNKQTTQFFTQLEIDPQTTEWDSKTKKINGKG
ASSLNSQLRNIEARIRTTYQEMFLRGPVLSAEQVKNAFLGIDDSSTTLLSVFQEYKQHQK
DMIGKCRSLSTYKRITLVYNRVADFIKVKHHRSDMYAAEIDGSFVDDFSDYLFTTYKVSN
NQVQKIMQVFKHVTKICIKKGLLKKDPFSDYKIKFDPVDPNFLTVDELKLIIQKKFSLRS
LETTKDLFVFSCFTGLAFVDAMNLKRENITLAENGDMWIKITRQKTNIPSIIPVMDIAKS
IIKKYENQNDSYVLPRSPHQHVNAYLKQIASSCGIKKNMTFHMARHTYATTAMSFGVPIA
TIAKTMGHANMKMTQHYARVLPEKIIKDINVLNTATQTLQTLYQ
Download sequence
Identical sequences D4ILA8 E4MDY9 I3YPF6 R5UX32
gi|390947799|ref|YP_006411559.1| gi|479186135|ref|YP_007816481.1| WP_009598544.1.48748 WP_009598544.1.56960 WP_009598544.1.9852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]