SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390947814|ref|YP_006411574.1| from Alistipes finegoldii DSM 17242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390947814|ref|YP_006411574.1|
Domain Number 1 Region: 271-427
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.15e-22
Family beta-glycanases 0.00057
Further Details:      
 
Domain Number 2 Region: 66-143
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000000000425
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.016
Further Details:      
 
Domain Number 3 Region: 180-273
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 0.00000000127
Family beta-Galactosidase/glucuronidase domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|390947814|ref|YP_006411574.1|
Sequence length 434
Comment beta-galactosidase/beta-glucuronidase [Alistipes finegoldii DSM 17242]
Sequence
MRSILSIIALFSCCTLAAQEYIPTYGRELPRGEVIAYPTAQEAAAAFAGDTRYFTRLADW
TQKGNVFSTEFTVPFAWANRQVFFHLGWASADYEVRVNGKAVAYDSDCSAPAEFNLTRHA
QEGRNTLEIVVSAPSQVARLESWKSDPAPAIGPAWVMSQPTLRVRDVLTKSWRSSEENDK
VMAEIALVVKTESLNPRTSRIHYELLTPAGSNAAIGYKDVTLDMRREDTVRFLARIPDSM
LWNPGRPTQYTLRVKTQHEGRYMEYIELPLGFRTVELRNGQLAVNGNPVALRTREVPPQF
PAEEIAKLREQGFNTLRLLPGPVSPALYAVCDTMGMYVIPQAPIDTRSSGESRRIGGNPS
NDPAWQNAYVERTEDSYHTSKRHPSVIAFSLATKSANGINLYESYLNMKKFSETRPFIYP
DAAGEWNSDGLKLE
Download sequence
Identical sequences A0A1Q6ER42 E4MCI6 I3YPH1
WP_009598025.1.56960 WP_009598025.1.9852 gi|390947814|ref|YP_006411574.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]