SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390947863|ref|YP_006411623.1| from Alistipes finegoldii DSM 17242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390947863|ref|YP_006411623.1|
Domain Number 1 Region: 10-271
Classification Level Classification E-value
Superfamily Phosphoenolpyruvate/pyruvate domain 1.33e-102
Family Ketopantoate hydroxymethyltransferase PanB 0.00000059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|390947863|ref|YP_006411623.1|
Sequence length 271
Comment ketopantoate hydroxymethyltransferase [Alistipes finegoldii DSM 17242]
Sequence
MSVESTVRAVTTYRLTEMKQRGEKIAMLTSYDYSMAKIVDAAGIDVILVGDSAANVMAGY
ETTLPITLDMMIYHACSVVRAVNRALVVVDLPFGTYQGNSKVALDSAVRIMKETEADAVK
IEGGEEILESVNRILSAGIPVMGHLGLTPQSIHKFGTYNVRAKEEAEAEKLVRDAHLLSE
AGCFGIVLEKIPAALAARVTGEIPTPTIGIGAGGACDGQVLVIHDMLGINKGFSPRFLRR
YADLHELMTGAVQQYIKDVKECDFPSEKEQY
Download sequence
Identical sequences E4MCR5 I3YPM0
gi|390947863|ref|YP_006411623.1| WP_009597956.1.56960 WP_009597956.1.9852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]