SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390947873|ref|YP_006411633.1| from Alistipes finegoldii DSM 17242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390947873|ref|YP_006411633.1|
Domain Number 1 Region: 113-390
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 0.00000000000000981
Family Lambda integrase-like, catalytic core 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|390947873|ref|YP_006411633.1|
Sequence length 455
Comment hypothetical protein Alfi_2688 [Alistipes finegoldii DSM 17242]
Sequence
MPTFKTVIHPPYKRADGTFRVKIRITHNKQSRYLPTPYYASAAEVNDKFDFKRGTSYVDD
TRPIIDKYRKVCNKYADKIDTMDVGQIVELIQNFKDEENFKLDFFAYGQLHIERLKATGR
IQNATMYGTALSALRRFIGRDNLDIREITSKFVGRFIDFLIQEPPRPGHKKGRRAPSLYF
STLQALHNAAKREYNDEDLGIIRIQLSPFSKVKKPPIPTTDKQPLSLAQFRKLLTIPDDT
SFVRKGDCNLQDLGRDVGILTFLLIGINTVDLYEAKGIQNGRLIYNRKKTKNRRTDNARV
NIRIEPEVMPLIEKYRDPTGVRLFNFHRLYKSVNNFNRSANIGLKRIGKIIGFKDLETYT
FRRTWASFAWNYCGIRDDIIDFALGHSPRSASKLAHIYITEDWDVVDQANRLVIDCIFSN
RVNTIIKNTIQTQQITLIAPNNPSSTLGQRLIASR
Download sequence
Identical sequences A0A174BR07 I3YPN0
WP_014776161.1.56960 WP_014776161.1.76885 gi|390947873|ref|YP_006411633.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]