SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390947910|ref|YP_006411670.1| from Alistipes finegoldii DSM 17242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390947910|ref|YP_006411670.1|
Domain Number 1 Region: 37-478
Classification Level Classification E-value
Superfamily Stabilizer of iron transporter SufD 5.49e-138
Family Stabilizer of iron transporter SufD 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|390947910|ref|YP_006411670.1|
Sequence length 481
Comment FeS assembly protein SufB [Alistipes finegoldii DSM 17242]
Sequence
MAEKDKDILENIGEQEYKYGFTSDIETETIGKGLSEDVVRLISAKKGEPAWMTERRVAAY
RHWLTMEPPTWAHLTIPEIDFQDIIYYAAPKQQKKLDSMDEVDPELKRTFDKLGIPLEEQ
MALAGVAVDAVMDSVSVKTTFKEVLAEKGIIFCSISEALRDFPDLVKKYLGSVVPYTDNF
YAALNAAVFSDGSFCYIPKGVRCPMELSTYFRINAAGTGQFERTLIVADEGAYVSYLEGC
TAPRRDENQLHAAVVEIIVEKDAEVKYSTVQNWYPGDKEGRGGIYNFVTKRGICRENARL
SWTQVETGSAITWKYPSCILAGDNSVGEFYSVAMTNNFQQADTGTKMIHIGRNTRSRIVS
KGISAGRSENSYRGLVRMAKGAENARNYSQCDSLLIGDKCGAHTFPVIDSRNRTAVVEHE
ATTSKISDDQLFYCNQRGLSTEDAVGLIVNGYAREVLAKLPMEFAVEAQKLLSISLEGSV
G
Download sequence
Identical sequences I3YPR7
WP_014776198.1.56960 gi|390947910|ref|YP_006411670.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]