SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390947913|ref|YP_006411673.1| from Alistipes finegoldii DSM 17242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390947913|ref|YP_006411673.1|
Domain Number 1 Region: 32-272
Classification Level Classification E-value
Superfamily Stabilizer of iron transporter SufD 4.18e-57
Family Stabilizer of iron transporter SufD 0.0000783
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|390947913|ref|YP_006411673.1|
Sequence length 273
Comment Fe-S cluster assembly ABC transporter permease [Alistipes finegoldii DSM 17242]
Sequence
MTAILDIIRDFRTAQGEVFRIEGTQDGPYAAVDPRRMRIEAAAGASGRIVVVHTAPDMSS
LEVVAAEDARLEITEVFLAEAFAEVAVKQSARSLCRLTAVQLTSANVSYTIDLDGRDAEN
MLGGVFLAGGEEHCVVKLRTNHNVPDCRSNSYIKGVAGGSARGEFCGLVYVAPDAQHTDA
QQQNRNILLSETAHIATQPQLEIYADDVKCSHGATVGQMDSEAVLYMRQRGLSEVQARRL
QIEGFVGDVVRRCGVEPLCETMMEAVRAKMEKL
Download sequence
Identical sequences I3YPS0
gi|390947913|ref|YP_006411673.1| WP_014776201.1.56960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]