SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390947930|ref|YP_006411690.1| from Alistipes finegoldii DSM 17242

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|390947930|ref|YP_006411690.1|
Domain Number - Region: 827-895
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0113
Family Fibronectin type III 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|390947930|ref|YP_006411690.1|
Sequence length 1370
Comment hypothetical protein Alfi_2748 [Alistipes finegoldii DSM 17242]
Sequence
MKKLNLLRLLFGAMFLIAATAFTSCVDDNDDDGMPYLEVAPEALTFSAEGVAEGASAVTV
KSNRPWTLAFESGADWVTPSATDGKAGTTEVEFSIPASNESRTATLSFQLKNSYGAYFTK
TVTINQGEVVPEKLVYKETFGTTGDKTPVASYDGWDKTGEGSSTVTYAGEGVDIRSNLSS
VGNGSAYEGSGGSNLMFGTGNTYFTVQDITLPQGQTGYTLTFGASYFNAPNIEIYDQLTV
QFSKDGEKWTNAIPYTFENFVAEKNWNLATLNFTLKEFSEHLYIKFLSTKKPDGNYRIDD
VTLVTSAGGQQVDLDNGSVTPPVGDVELPTTVVTQFGDSFNDVISGVVYDSPNWAFTSSD
AGYPANPKLGWFGSVFGDTFYLQCAPYSSTQKTVTAYAIMTPFNVKAADNKVLTFKLAWY
FNATASAADDSKIEIVASTTVTNETITDPSVWTVVKTIEYKEGVNEINVYFDESADLSAY
AASDKVYVAFRYVGHNNTYRLDDVSFNGGATGSLVVDPTAISLGDAAGATAKITVTSTGD
WKATVSGSGFSIDKTTGTASDTSITVTASEANASSEIKNLGSIVVSNDFGTKTIAVSQKG
VSNDIFYESFGDLEQKLDKWPYINESPYVIRSGFGYVSGTSDYKTAYASNRWTATTASPT
SAGFSGKGLMWLQAGKNAYFTVQDLVLTTEKNLSIRFGLYGNTDAFDPQKDVIKLYLSSD
AENWTEIAYNLENVDATPAWKWASADITLKNTVSRLSLKIEYPSGATGTRVDDVRIFVGT
GGTEIDLGGGAATPAVTTANASNVAETTVTLGGSIANADLADYSAVGVEYVVFATGNTPD
WTGSVKVPAATKAATWTVDVTGLTKETQYAFRAYATPNTGDILYGDHKTFVTTGGSGGAT
TITIPELLAKITATSAAEVIDENVTYTFEGVICGDPKAGNASFGTLYVMTPGATTGGNGI
SLYNSVFWSEGDYKLGDKVLVTLTAGVAKGQIRNSIPQVSEIGTGEVIVQSSGNAVTPIK
VNSVADISNYFNMPVTIEATTSAAGMWMDSGANTTRTLTAGGANLAVYLNKNAWTTFKDQ
PYIATTAEITGIGAVYSGQNQILPRNLDDVKNFKSTAPMIIDVTPSSLSWASDDTAEKTV
TIEGVNFNGFTLSSLTSFNASVEGTTVKISPKTANTGDTDIKETLTITATGGNDATVALT
QLKKSSGGEVTPGVAYVWSLVNGDLGSKADGVTIVKGTPELEWITSPTWSGSSFYFGNDN
NKGVQVGSKNQPASQFVLKSTAYTGGVKKIVVNSSGAASANVTLKVQVGSTTFVCDGNST
ADLTSLAAEYTFENAVAVEGDIVLTWDNATSVAGSGKAFYIKSVAINPAE
Download sequence
Identical sequences I3YPT7
WP_014776215.1.56960 gi|390947930|ref|YP_006411690.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]