SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390948156|ref|YP_006411916.1| from Alistipes finegoldii DSM 17242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390948156|ref|YP_006411916.1|
Domain Number 1 Region: 599-689
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000111
Family Fibronectin type III 0.0072
Further Details:      
 
Domain Number 2 Region: 479-587
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 0.0000289
Family N-acetylmuramoyl-L-alanine amidase-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|390948156|ref|YP_006411916.1|
Sequence length 994
Comment hypothetical protein Alfi_2986 [Alistipes finegoldii DSM 17242]
Sequence
MKNRLLYILLLLGLCGQEVSAAGIDGPARREIGRTLTRIVAREVSGGYVRIEGVDASRKR
VRIYTSVGLSYYPFREENLRAMRDSVRLLMPPEFRKADIELYSDKREVGELIPMACRTGA
EYRKLLRKKKIVPFTNRSERPLVTRSSAPVVPSQGLAGRHIALWQSHGRYFDQPQNRWKW
QRSQLWQTCEDLYTQSYVLPYLVPMLENAGACVMLPRERDVQKYEILADNDAAGQYREEE
GPEKWQPGGMGFAHVQQVYTTGQNPFRDGTTRRVRSVTGGAESRAVWTADIPERGEYAVY
VSYDSTPQNADDAQYTVHHLGGDSSFAVNQTMGGGTWIYLGRFLLDAGSQEVVTLTNRSR
QAGRIVSADAVKIGGGYGNIARTVCDSLRRPGMVCHLETSGYPRFCEGARYWLQWAGFDE
KVYSPKENRDDYKDDYMSRAHWVNALTGGSERMPDSAGLRIPVDMALAFHSDVGVRLNDD
IIGTLGIFYTRENKGKFEGGADRYRSRDLTDIVMTQIVEDIRSTYEPAWSRRGLWNRAYY
EARVPGVPTMLLELLSHQNFADMRYGSDPRFKFLVSRAVYKGILRYISSQYGLPYVVQPL
PVESLAVQFAEGGKAAVTWSPVMDSLETTAAPTGYVVYTRIDDGGFDNGRYVDKPCLLTA
QEPGRIYSYKVTAVNEGGESFPCETVAACRMPDEKGTVLIVNGFDRVSAPLSVRADSLAG
FYTDIDGGVPDRQDISFIGAQHVFDMQMAKCEVDSIALGACACDYETEVIGGNTFDYPAL
HGRSVAGAGYSFCSASVRAVERGEVSPDGYSAVDLILGEQRSTTIGRGVTGYAFKTFSPE
LQAVLRRYMAGGGALFVSGSYVATDLWTGGEASDDDRRFAEEVLHYTYDGGRAAQRGRVR
VVTSHPGFSRDEYRYVNEYRPDRYRVESPDALRPAGAGAFSVMRYVENGRTAGVASEAGG
TFVMGFPFESIESDVQRDRLMRDVLDFLLKQKDR
Download sequence
Identical sequences A0A1Q6EY06 I3YQG3
WP_014776369.1.56960 gi|390948156|ref|YP_006411916.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]