SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390948203|ref|YP_006411963.1| from Alistipes finegoldii DSM 17242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390948203|ref|YP_006411963.1|
Domain Number 1 Region: 284-582
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 4.45e-80
Family DNA repair protein MutS, domain III 0.00000181
Further Details:      
 
Domain Number 2 Region: 585-820
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.08e-57
Family ABC transporter ATPase domain-like 0.00000112
Further Details:      
 
Domain Number 3 Region: 130-282
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 9.42e-37
Family DNA repair protein MutS, domain II 0.00032
Further Details:      
 
Domain Number 4 Region: 23-129
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 2.62e-36
Family DNA repair protein MutS, domain I 0.0000381
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|390948203|ref|YP_006411963.1|
Sequence length 902
Comment DNA mismatch repair protein MutS [Alistipes finegoldii DSM 17242]
Sequence
MCENNIQFFIVNAEKKIEKKYVETPLMKQYYSIKAVHPDAILLFRVGDFYETFGEDAIKA
SGILGITLTRRANGSATYVELAGFPYHAIDTYLPKLVRAGERVAICEQLEDPKQVRGLVK
RGVIELVTPGVVLGDNILANKENAFLASVYFGRQTTGVAFLDISTGEFYVAEGSESYIDK
LISNLAPKEVIYQRGYEDRFSDAFGSKLYTYRLDEWVFSEEVNREKLCKQFGTRSLKGFG
VDHFTSGLSAAGAILYYLEFTEHRDIAHITSISRIDQEDYVWVDKFTIRNLELFSSNGAR
EKCSFADVIDRTLTPMGGRLLKRWIAMPIKDPVKIGERLDVVEKFVRDADLADVVREQVA
LVGDMERIASRIAAARVTPRELVQLKNSLFAVELLKAALESTDDAQLHALAGQIDLLEGV
RDRIAREIYPDPLNNQIQKGGVIADGVDPELDDLRRIALHGKDYLARIQQRESEATGIPS
LKISYNNVFGYYIEVRNAHKEKVPETWIRKQTLANAERYITEELKEYEEKILGAEEKMLV
IEQRIYADIIDHISRSLSHLLRDAAVVARIDCLQSFARLACERRYVRPVLDDGKLIDIRQ
GRHPVIETLLPVGEEYVPNDVMLDDKEQQIMMITGPNMSGKSALLRQTALIILMAQMGSF
VPAKSAHIGVVDKIFTRVGASDNISQGESTFMVEMLESASILNNISDRSIVLLDEIGRGT
STYDGISIAWAMVEYLHNHPSAHAKTLFATHYHELNEMEQMCPRVKNFHVSVKEMGNQIV
FLRKLERGGTEHSFGIHVARMAGMPVSVVSRADEILRNLELVYGNNEIVPSRSIKNRGKK
PSPSVKEAAENGAPQNMQLSMFQLDDPVLVQIRDQIKGLDINSLTPIEALNKLNEIKKIT
GI
Download sequence
Identical sequences I3YQL0
gi|390948203|ref|YP_006411963.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]