SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390948244|ref|YP_006412004.1| from Alistipes finegoldii DSM 17242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390948244|ref|YP_006412004.1|
Domain Number 1 Region: 496-649
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000969
Family Fibronectin type III 0.0054
Further Details:      
 
Domain Number 2 Region: 39-229
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000581
Family Fibronectin type III 0.0065
Further Details:      
 
Weak hits

Sequence:  gi|390948244|ref|YP_006412004.1|
Domain Number - Region: 669-774
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00011
Family Fibronectin type III 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|390948244|ref|YP_006412004.1|
Sequence length 997
Comment fibronectin type III domain-containing protein [Alistipes finegoldii DSM 17242]
Sequence
MKKSIIYILFALFSFSAAVSLTACKDDGVEISDAYKSKTPKNVKLLEYGNKSLTICWDFV
RGATSYTVQLVDGDMNPVSEALCMTTADIDYHEFTDLPTDRIYYGRVRANYPYSATSDWV
YVTEHDKPAMLMASVGILDLDPQLKLHAASGSTLTFEWSYTDDKATDAARSYNVELFRDE
ACTDLYVSWLADGKLSSGKGIFTALAGYPVVRYTFSGLDPETTYYARITNLSFADIQTPV
VAGTTAQAGPKAAANTPAKAGDIVLAQDFSAFIHGGDIVNSAAGYNAVSGTDFRKTWEKA
EGVNPQADGDRPLCNWATEFHIHTGGTSAEYVEALGMKGWGSSGNTSTRPGYIKCGGGSG
GIGILYTPQLTALPANTTVKVSFSASAYAEGENVYGSDIVVEAVEGAEFGSNNVVSKKGT
AFVSKTVDISSAVGRFETYTVTLEGLTPASRIAFSSNPAQAGANKTRFLLDDIVVTCEGE
THLEQLAAPANVKFDAEAVQPDKLTLKWDAVSGAASYTVACWADGTDESKAALVEKIDGT
ACTLDKLTPETKYNAKVKAVAGRTATDSDWSAKASATTAEASQGKLDAPANLKAEPGFST
VALTWDAVSGATGYSVTVDNGTPQTVTDNAFTATGLTAGTSHDFSVVALAALAADNSDAA
TLQSKTLYVRIAAVTTSSIILEWEQAGDVSQYTVAIEEEGDPSRSARFTYDWSKASGYGS
IPLRFAFNYVGTEWASAALSPSASYRLRVKAGAADSDSAWSNDITGTVARRTAPAGEVFY
EDFDRFMGGDAVMTAVGVKSAKKVTSEAGLSTMLTEFTYTDWSAGGGAMNAGSGTYGDPY
RLMFFKDDGWETGALVTGNGVHNAFCGSFRLGGDNANQSYVQTPAMSGLTAAANVTVTFK
TAVNVWTAASTTAPAVVFKAGWCRDQFESMELYVVHDDGTKVKVGDTIAVGDAGNELAWK
SHSVVIEGLLPTDKLMFTSVGAKKSRYYLDEISVVKN
Download sequence
Identical sequences I3YQQ1
gi|390948244|ref|YP_006412004.1| WP_014776447.1.56960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]