SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390948341|ref|YP_006412101.1| from Alistipes finegoldii DSM 17242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390948341|ref|YP_006412101.1|
Domain Number 1 Region: 2-224
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.64e-54
Family G proteins 0.0001
Further Details:      
 
Domain Number 2 Region: 399-494
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 8.63e-23
Family EF-G/eEF-2 domains III and V 0.017
Further Details:      
 
Domain Number 3 Region: 292-370
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 3.96e-18
Family EF-G/eEF-2 domains III and V 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|390948341|ref|YP_006412101.1|
Sequence length 596
Comment GTP-binding protein LepA [Alistipes finegoldii DSM 17242]
Sequence
MKNIRNFCIIAHIDHGKSTLADRLLEKTNTLNQREMQAQVLDDMDLEREKGITIKSHAIQ
MEYKARDGQLYTLNLIDTPGHVDFSYEVSRAIASCEGALLVVDATQGIQAQTISNLYLAV
GHDLEIIPVLNKIDMDSAMIDEVKDQVIDLIGCKDEDILLASGKTGLGVEEVLEAIVQRI
PAPEGDENAPLQALIFDSVFNPFRGIIAYYRVFNGRIRKGEHVKFFNTGSQYDADEVGVL
KLKMQPRDEIKAGDVGYICSGIKTSSDVKVGDTITTVTNPAREAIAGFEDVKPMVFAGVY
PVEADQYEDLRASLEKLQLNDASLTFEPESSLALGFGFRCGFLGLLHMEIIQERLYREFD
MDVITTVPNVSYRITTTQGDVVEVHNPSGLPEVTKIAKIEEPYILAQIITKSEFLGNVIK
LCIDKRGVMKNQTFITQDRVEINFDMPLSEIVFDFYDKLKSISKGYASFDYHRTGYQPSK
LVKLDILLNGEPVDALSSLTYTDHAYDFGRKMCEKLKELIPRQQFDIAIQAAIGAKIIAR
ETVKAVRKDVTAKCYGGDISRKRKLLEKQKKGKKRMRQIGNVEVPQSAFLAVLKMD
Download sequence
Identical sequences A0A1Q6EQU6 I3YQZ8
WP_014776518.1.56960 WP_014776518.1.9852 gi|390948341|ref|YP_006412101.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]