SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390948344|ref|YP_006412104.1| from Alistipes finegoldii DSM 17242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390948344|ref|YP_006412104.1|
Domain Number 1 Region: 44-315
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 1.68e-36
Family Lambda integrase-like, catalytic core 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|390948344|ref|YP_006412104.1|
Sequence length 323
Comment site-specific recombinase XerD [Alistipes finegoldii DSM 17242]
Sequence
MTYSPDSVGMHRHTFTGRPAFTGQPRSKTPPDFMSCFALHVAECEQTGRDGSAANYLTAY
RMLVKYMNGRKLLPEQFTAEWLERYERWLLARGLGTNSVVFHMRYLRAVYNKAADRGSFI
ASRGNPFYRRHIRQVATRKRALPRETLRRISDADLSELHPKYALARDLFMFSFYTRGMSF
VDMIYLRKSDISDGVLTYKRKKTGQTLTLRIEPPLQRIIDRYNGDSPYILPVLARDDSYR
AYRQQQRELNKFIRKIGAMLEISEPLTFYAARHSWATLARDCGTPLTVISAGMGHTSERT
TRIYLAQLDHDVIDKANRKIINL
Download sequence
Identical sequences E4MF26 I3YR01 R5UD71
WP_009598960.1.56960 WP_009598960.1.9852 gi|390948344|ref|YP_006412104.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]