SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390948387|ref|YP_006412147.1| from Alistipes finegoldii DSM 17242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390948387|ref|YP_006412147.1|
Domain Number 1 Region: 27-152
Classification Level Classification E-value
Superfamily Flavoproteins 6.42e-22
Family Flavodoxin-related 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|390948387|ref|YP_006412147.1|
Sequence length 185
Comment flavodoxin [Alistipes finegoldii DSM 17242]
Sequence
MKRIVLIAIMTMFLPDMNTQAQTASGTKVLVAYFSHSGNTRAMARQIAEATGGDLFEIVP
AAAYPAEYGAVVDQAKKEIGGGVRPALKGRLPDVGAYDVIFVGSPCWWSTVAPPVATFLA
DCDWAGKTVVPFMTHEGSRMGRSEEDIRKLCAGATLLGGLPLRGGAVKDSRDVVRKWVQG
LNLTK
Download sequence
Identical sequences E4MCW6 I3YR44 R5UFI3
gi|390948387|ref|YP_006412147.1| WP_009598160.1.56960 WP_009598160.1.9852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]