SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|390948450|ref|YP_006412210.1| from Alistipes finegoldii DSM 17242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390948450|ref|YP_006412210.1|
Domain Number 1 Region: 6-133
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.83e-39
Family YigZ N-terminal domain-like 0.00017
Further Details:      
 
Weak hits

Sequence:  gi|390948450|ref|YP_006412210.1|
Domain Number - Region: 139-191
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 0.00345
Family EF-G/eEF-2 domains III and V 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|390948450|ref|YP_006412210.1|
Sequence length 202
Comment hypothetical protein Alfi_3297 [Alistipes finegoldii DSM 17242]
Sequence
MEPEDSYLTIAAPAEAASRERSSKFLAYAYPVQQEEQIREILDGLRKKYYDATHHCYAWR
LGPGGAAFRANDDGEPSGTAGKPILGQLLSNNLTDCLIVVVRYFGGTKLGVPGLIAAYRE
SAAEAIAAARIVERTVDRTIRVDFPYIAMNDIMRVIKEQQPKIASQEFDNLCTMVLTIRE
SRAGELTEKLKKAGGSIAGEDI
Download sequence
Identical sequences I3YRA7
WP_014776597.1.56960 gi|390948450|ref|YP_006412210.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]