SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|399535012|ref|YP_006547674.1| from Amycolatopsis mediterranei S699

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|399535012|ref|YP_006547674.1|
Domain Number 1 Region: 14-91
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.48e-18
Family GntR-like transcriptional regulators 0.011
Further Details:      
 
Domain Number 2 Region: 108-236
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 1.02e-17
Family GntR ligand-binding domain-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|399535012|ref|YP_006547674.1|
Sequence length 244
Comment GntR family transcriptional regulator [Amycolatopsis mediterranei S699]
Sequence
MRKGMSHSARSAMFAPLGQVGRAEAVAARLVDAITLGLLADQEQLPSEADLAAQFGVSTV
TVREALVALRQQGLVETRRGRSGGSFVRAPANPPPDAWRARLREVSLSDLRDVGDHYLAI
AGAAAKLAAERSSPEDVARLRLATDDLRTARGLDFTRAERQFHLEVAAAAQSPRLTHEEV
HLQSELGGLLWLPLGPAAPSCEEHAAITAAIDAADGELARKLTEEHLLRALDRLADVHLA
LLTP
Download sequence
Identical sequences A0A0H3CY55 G0G628
gi|399535012|ref|YP_006547674.1| gi|399535012|ref|YP_006547674.1| gi|300783126|ref|YP_003763417.1| gi|532457874|ref|YP_008457526.1| WP_013223104.1.26188 WP_013223104.1.53613 WP_013223104.1.63706 WP_013223104.1.79787 WP_013223104.1.88400 WP_013223104.1.99940 YP_003763417.1.66228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]