SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|399535558|ref|YP_006548220.1| from Amycolatopsis mediterranei S699

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|399535558|ref|YP_006548220.1|
Domain Number 1 Region: 4-196
Classification Level Classification E-value
Superfamily DhaL-like 7.98e-32
Family DhaL-like 0.0054
Further Details:      
 
Weak hits

Sequence:  gi|399535558|ref|YP_006548220.1|
Domain Number - Region: 313-396
Classification Level Classification E-value
Superfamily Tetrapyrrole methylase 0.0733
Family Tetrapyrrole methylase 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|399535558|ref|YP_006548220.1|
Sequence length 524
Comment dihydroxyacetone kinase [Amycolatopsis mediterranei S699]
Sequence
MRVLDAAAVSAWAAGCVHSLASLRPAIDEINVYPVADSDTGSNMLFTMTGAARELSEATP
GDAAEALKVLARGAVASAKGNSGVILSQVVRGLADRAEGDLDGPWLARALGHADEVATGA
VSRPVAGTILTVLHAVALAVRGDTSSLGDIAAKAAKEAAHALEKTPEQLPALARAGVVDA
GARGLVAVLDALVGVLTGTPLEQEHALEVRTELPDAYAWEVMYLLDGVDEASLPTLRKEL
SGLGDSVTVAGDGSGSHAVHVHCADIGAAIEAGLALGRPRRIRVEPLLTPTPIEPGGGID
RTVVAVVHGGALAELLRAESIPVLAVPEGGTPSVEDMIGLFNEAAGRQVTVLPGSVALTA
AADTAAGHAMAADRDVVVIPCASPVQVLAALAVHDAGRRTNDDVVAMAEAAAATRRGELR
IAQEESLTWVGRAQSGDVVGLVDDEVVLIEPAPASETNLVAAAMKVLNRMLALGGELVTV
LSGAAAPPGVAEELAEQLRVEHPEVEMAGYASGQADAVLLMGVE
Download sequence
Identical sequences A0A0H3CYX5 G0FPG6
gi|300783674|ref|YP_003763965.1| WP_013223646.1.26188 WP_013223646.1.53613 WP_013223646.1.63706 WP_013223646.1.79787 WP_013223646.1.88400 WP_013223646.1.99940 YP_003763965.1.66228 gi|532458420|ref|YP_008458072.1| gi|399535558|ref|YP_006548220.1| gi|399535558|ref|YP_006548220.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]