SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|399540297|ref|YP_006552959.1| from Amycolatopsis mediterranei S699

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|399540297|ref|YP_006552959.1|
Domain Number 1 Region: 5-346
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.08e-56
Family TK-like PP module 0.027
Further Details:      
 
Domain Number 2 Region: 354-568
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.46e-23
Family TK-like Pyr module 0.034
Further Details:      
 
Weak hits

Sequence:  gi|399540297|ref|YP_006552959.1|
Domain Number - Region: 572-721
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0471
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|399540297|ref|YP_006552959.1|
Sequence length 764
Comment phosphoketolase [Amycolatopsis mediterranei S699]
Sequence
MPARAETLRRYRRACDYLAAAMIHLKDNVLLTEPLRPEHLKPRPLGHWGTCPGLTLVYAG
LNRLVAETGQRTLLVTGPGHGAPAIHANLWLEGTHAVHDPRLGLDGHGLAELVRRFSWPG
GFPSHLSPEVPGVIHEGGELGYALATAFGAALDDPGLLVACVVGDGEAETGPTAAAWHSP
KFTGPGDGRVLPILHLNGYKIASPTIYEAMSDDELTAYFTGCGWHPEIVDVRGTDDPDTP
LAEALARAHEQPSGPPPMIVLRSTKGLGLPATSPDGTPLAGTFHAHQVPLPSAAGDPDEL
AALERWLRSYRPEELFGADGVPAPDLLEVPPAPELRLGRVPQANGGQLRRDLPLPDVEKY
AVAVDRPGGVDASAPEVLAGWLAELIGRAPETFRVVCPDELESNKLGGLLEATSRQFDAE
VPGYSEHLATRGRVQEVLSEHLCQGWLQGYLLTGRHGLFPCYEAFVSIVDSMVNQYAKFL
KMSAEVSWRAPVASLNYLLSSDGWRQEHNGYSHQGPGFINQMLTKKATTARVYLPPDANT
LLEVMHRCLASTDLINVVVTGKQSSPQWLSPEEARAHCRAGASVWEWASTADGDADVVLA
CAGTTPTLETIAAAELLRELAPDLRVRVVNVVDLLSLCPPDRHPHGLADEAFTACFGDDL
PVVFAFHGYPSAVHEVLHGRPATARFHVHGYREEGTTTTPFDLLASNRMTRHDLAADAVT
RARGWASAGGDLARELVKRRDALLVQSYRDGQDPEEITGWRWRG
Download sequence
Identical sequences A0A0H3DE20 G0FTZ3
gi|399540297|ref|YP_006552959.1| WP_013228352.1.26188 WP_013228352.1.53613 WP_013228352.1.63706 WP_013228352.1.79787 WP_013228352.1.88400 WP_013228352.1.99940 YP_003768705.1.66228 gi|399540297|ref|YP_006552959.1| gi|532463158|ref|YP_008462810.1| gi|300788414|ref|YP_003768705.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]