SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|399541647|ref|YP_006554309.1| from Amycolatopsis mediterranei S699

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|399541647|ref|YP_006554309.1|
Domain Number 1 Region: 405-821
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.44e-83
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.0054
Further Details:      
 
Domain Number 2 Region: 97-338
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 1.25e-54
Family CAT-like 0.00019
Further Details:      
 
Domain Number 3 Region: 862-1075
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.24e-44
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|399541647|ref|YP_006554309.1|
Sequence length 1216
Comment 2-oxoglutarate decarboxylase [Amycolatopsis mediterranei S699]
Sequence
MYDQFLADPSSVDAAWHDFFADFKPTQSAQAKADTARQQQAGAKPAANGQAAQPSAKAVQ
NAESAAKQSSTAPAAKPAPAKAAPKQAPKPAAKAEPKAEAKKEEPESKQLRGAAAAIAKN
MDASLSVPTATSVRAVPAKLMADNRIVINNHLKRTRGGKISFTHLIGYAMVRALKAYPNM
NRHYQLIDGKPFAITPEHVNFGLAIDMKGKDGSRTLVVASIKGCEDMSFLQFWQAYEDIV
KKARNNKLTADDFSGTTISLTNPGGIGTNHSVPRLQAGQGAIIGVGAMQYPAAFEGTSEK
TLVDLGISKIMTLTSTYDHRIIQGAESGEFLKRIHQLLLGEDGFYDDVFTSLRLPYEPIR
WVADIPDGPVDKTARVIELIDAFRMRGHLMADTDPLNYRQRSHADLDVLSHGLTLWDLDR
EFPVGGFAGQERMKLRDILGVLRNSYCRTVGIEYTHILDPEERRWIQERVEIPHEKPDPA
VQKYVLSKLNAAEAFETFLQTKYVGQKRFSLEGGETAIPLLDTILDKAAEHELDEVVIGM
PHRGRLNVLANIVGKPISQIFQEFEGNLDPGQAHGSGDVKYHLGAEGKYFRMFGDGETKV
SLTANPSHLETVDPVLEGIVRAKQDILDKGGEGYTVLPVLMHGDAAFAGQGVVAETLNLS
LLRGYRTGGTVHVIVNNQVGFTTAPEHSRSSQYATDVAKMIGSPIFHVNGDDPEAAHWVA
KLAVEYRQAFHKDVVIDLICYRRRGHNEGDDPSMTQPAMYDIIDTKRSVRKTYTESLIGR
GDISVEEAEAALRDFSSQLEHVFNEVRELEKHPAKASPSVEEEQQVPAKVATAITGKTLE
HIGDAFVNVPDGFTPHPRVKPVMERRHKMSREGDIDWAFGELLAFGSLAMEGRLVRLSGQ
DSRRGTFTQRHSVFIDRKTGQEYSPLQNLADGQGRVMIYDSALSEYAAVGFEYGYSVANP
ESLVMWEAQFGDFVNGAQTVIDEYISSGEAKWGQRSDVVLLLPHGHEGQGPDHTSGRIER
FLSLCAEGSMTVAVPSTPANYFHLLRRHALDGIQRPLVVFTPKSMLRNKAATSPTEDFTG
ESRFMSVIDDVTPDPAKIRKVLLTSGKLYWELVAERTKREADDVAIVRIEQYYPLPKKKL
LAALERYTNATQVAWVQEEPENQGAWPFFGLNLPRKFPEVLSGLQVVSRRPMAAPSAGSS
KVHEVEQKALIAKAFD
Download sequence
Identical sequences A0A0H3DJ00
gi|300789765|ref|YP_003770056.1| YP_003770056.1.66228 gi|399541647|ref|YP_006554309.1| gi|399541647|ref|YP_006554309.1| gi|532464508|ref|YP_008464160.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]