SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392406664|ref|YP_006443272.1| from Anaerobaculum mobile DSM 13181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392406664|ref|YP_006443272.1|
Domain Number 1 Region: 166-353
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 2.22e-60
Family Methylesterase CheB, C-terminal domain 0.00000848
Further Details:      
 
Domain Number 2 Region: 9-118
Classification Level Classification E-value
Superfamily CheY-like 1.99e-30
Family CheY-related 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|392406664|ref|YP_006443272.1|
Sequence length 360
Comment chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain [Anaerobaculum mobile DSM 13181]
Sequence
MQVTGFMIKQIKVLVVDDSAFMRKVISDLLEEDPHIKVIDRARNGKEAVEKVIKLQPDVV
TLDVEMPQMDGLAALREIMRLKPTPVIMVSSLTRQGAETTIKALALGAIDFVTKPSGTIS
LDMKTVAQELREKVIAAASVAVEKLTGVAALPMIEVKKAPITRKGQVELVAIAASTGGPR
AIQRILEKIETTSIAPIVIVQHMPKGFTKSFAERLNEVSKLEVVEGYDNLPLKPGMAVVA
PGGSHLIVEYNKMRQLVCRLSDMPPLHSVKPAADLLFLSVADTVGGASLGVVLTGMGRDG
AEGAKAIRQKGGYVIAESSETCVIYGMPKAAVESGGVDEVLPLDVIPGRLEEMAVIRQKQ
Download sequence
Identical sequences I4BUJ0
WP_014806186.1.3424 gi|392406664|ref|YP_006443272.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]