SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392407254|ref|YP_006443862.1| from Anaerobaculum mobile DSM 13181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392407254|ref|YP_006443862.1|
Domain Number 1 Region: 292-513
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.4e-41
Family ABC transporter ATPase domain-like 0.00027
Further Details:      
 
Domain Number 2 Region: 28-282
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.00000000000000366
Family DNA repair protein MutS, domain III 0.016
Further Details:      
 
Domain Number 3 Region: 713-782
Classification Level Classification E-value
Superfamily SMR domain-like 0.000000157
Family Smr domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|392407254|ref|YP_006443862.1|
Sequence length 790
Comment MutS2 family protein [Anaerobaculum mobile DSM 13181]
Sequence
MISSKQTRQLLEIDKIIAKFYSKNIRSEIGKTYVRDIKPLTNIEALKDWQALYREFERYI
DVKGDFPWDDRLMPIGDLLEAGKSQGVLFGEELLPFKCMLGLAVRIKELSGELAREGYGK
LGEMARQFADFGDEVKAMSVVDEDGRLYDSASVKLAEIRNELDVAKRQARSIGQKIISDQ
SLSSKLQDQVIAMRNGRYVLLVKKDLAPSFPGIFVDYSSSGNSVYMEPHALVTMNNKIAM
LLEDERREERRICQKLTEMLLSRERAILKAQDLIGQIDLMWGIYYFLQANDWTLPEMEEK
SSFYLNNAHHPLLEPKAVPIDVHCGRNFKALVITGPNTGGKTVALKTVGLCVYLAWCGLP
IPAREGSRIGQFSSLEADIGDEQSIEQNLSTFSGHVKRIIDMLAQADDRSLFLIDELGAG
TDPEEGAALGIAILETFLKKGSLVLATTHHNSIKRYALLTQNVETASVDFDPETLQPKYK
LLLGVPGKSNALLIAKRLGMPDEVLEIAKRELKGSDTSMEDLLERLRAKLSALEEKEKEL
ANETANLKAAKRELERQLSGIEERRERILAEAERRAKKIVKEAQESAKLLLKELSKTHNL
ADAHRTFAKMREQTDKILDDIEREEATRIESKSSIAEGRIPRVGDKVKILGTNATGIVES
VDNEKATIQSGPIKVDVSLKKIRVIEESDKKEGQSIKINIERPQNVPSSIMIRGMRVSEA
MPLVETYLDKAFRAGYREVTIIHGRGEGILRQEVHALCRRLPYVEDFRLGGPGEGGYGVT
IVRFVNKGGS
Download sequence
Identical sequences I4BW80
WP_014806770.1.3424 gi|392407254|ref|YP_006443862.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]