SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392407470|ref|YP_006444078.1| from Anaerobaculum mobile DSM 13181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392407470|ref|YP_006444078.1|
Domain Number 1 Region: 5-116
Classification Level Classification E-value
Superfamily AF1862-like 0.000000000000654
Family Cas Cmr5-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|392407470|ref|YP_006444078.1|
Sequence length 121
Comment CRISPR type III-B/RAMP module-associated protein Cmr5 [Anaerobaculum mobile DSM 13181]
Sequence
MIHKNLEMAYKAMAMVKSVEEKRREDYLRTVRGLGSMIIGNGIAATLLFLKKKGFDEAIK
HLDELIGLKADMKDFSARIFSESMTNKSLTAAEYLNAQLAAIDGASWLKRYAEIYFGGDK
K
Download sequence
Identical sequences I4BWU6
gi|392407470|ref|YP_006444078.1| WP_014806984.1.3424 WP_014806984.1.68772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]