SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392407325|ref|YP_006443933.1| from Anaerobaculum mobile DSM 13181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392407325|ref|YP_006443933.1|
Domain Number 1 Region: 318-926
Classification Level Classification E-value
Superfamily Molybdenum cofactor-binding domain 1.44e-140
Family Molybdenum cofactor-binding domain 0.0000000000411
Further Details:      
 
Domain Number 2 Region: 170-337
Classification Level Classification E-value
Superfamily CO dehydrogenase molybdoprotein N-domain-like 6.93e-34
Family CO dehydrogenase molybdoprotein N-domain-like 0.0000953
Further Details:      
 
Domain Number 3 Region: 89-186
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 2.62e-32
Family CO dehydrogenase ISP C-domain like 0.0000157
Further Details:      
 
Domain Number 4 Region: 8-92
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.84e-19
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|392407325|ref|YP_006443933.1|
Sequence length 931
Comment aerobic-type carbon monoxide dehydrogenase, large subunit CoxL/CutL-like protein [Anaerobaculum mobile DSM 13181]
Sequence
MKQYLRKSIKVNGCPHHVVASPDAMLVNVIRKQLGLTGTKLGCGSGQCGACEVIMNGKLV
RSCIVRWDKVPQDAEILTIEGLGRPEKLHALQWAYVKTGAIQCGFCTPGFIMSSKALLDE
NPNPTREEVRDWFQKNRNACRCTGYVQIVDAVMLAAKVLRGEEEMTDFSELTRDGKIWGS
HYPRPSAVYKATGTWDFGDDVALKLPEETLFAACVCPETHHAIVKKIDFSEAEKMPGVYK
VVTAKDIYANKGTNRIRGQVGSKTATTNGWERRILVEEGDKIRQWGEAVAIVCADTEEHA
RAAADAVKVEIEELPALLNVKDAMAPGAVKVHEDIPDIDGIPNVFNKRPIKKGNDPKEDL
DKAPYVVEDEFYSSRQPHLTIETDCGFGYFDEEGRLTLQTKSICVYRHQLMIARGLGLPP
SKIRVIQNNMGATFGYKVGPTNEHLIGACVIATGRPVYMRLDMKEHIIRTPKRSPFLMKI
RVGADENGKLVGLEHYWYVDHGPYSESSQDLTNKGGQFMLAPYKVNNIRGCGYTVFTNHK
WCTAFRCYGGPQTYFGGELAIDMLAEKVGMDPLDFREKNLIQPGDTLPSGQRPEVYPLQA
MVTHIRPLYEEAKKQAAALSTDKIKHGVGVAIGIYNSNDDGPDEANSHIELTKDGVILYN
TWEDHGQGADMGCVGTAHEALRPLGLRPDQIKLVCNDTAKAPNSGAAAASRSQVMVGMAI
VDSCRKLLDAMRKPDGTHRTYDEMIAEGIPTYYEGYYKATLRNVNGEVQHCTGMDDETGQ
GYPFANHMFGVFLAEVSVDVTTGEAKVDRMTLACDVGKINNYAVVEGQLYGGIAQGIGFA
LKENFEDVKKHNNLLACGFPYIKDIPDNIRLIHMESPREFGPFGASGTGEAPLSAPHAAI
INAIHNACGIRIKTIPATPDRILKALEEAKK
Download sequence
Identical sequences I4BWF1
WP_014806841.1.3424 gi|392407325|ref|YP_006443933.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]