SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479188280|ref|YP_007818319.1| from Butyrivibrio fibrisolvens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479188280|ref|YP_007818319.1|
Domain Number 1 Region: 84-177
Classification Level Classification E-value
Superfamily Ribosomal protein L6 1.18e-34
Family Ribosomal protein L6 0.0000355
Further Details:      
 
Domain Number 2 Region: 1-83
Classification Level Classification E-value
Superfamily Ribosomal protein L6 3.4e-26
Family Ribosomal protein L6 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479188280|ref|YP_007818319.1|
Sequence length 179
Comment LSU ribosomal protein L6P [Butyrivibrio fibrisolvens 16/4]
Sequence
MSRIGRMPIAVPAGVTVEIAENNHVTVKGPKGTLERTLPSEMDIKLEGAEVVVTRPNDLK
KMKSLHGLTRTLINNMVVGVTDGYEKTLEVNGVGYRASKAGKKLTLNLGYSHPVEMEDPE
GIESTVDGNKIIIKGIDKEKVGQYAANIRDKRRPEPYKGKGIKYSDEVIRRKVGKTGKK
Download sequence
Identical sequences A0A1G5RTE4 A0A1G8IZV0 A0A1I5EQW8 A0A1M6F677 D4IZG4
gi|479188280|ref|YP_007818319.1| WP_015548346.1.33585 WP_015548346.1.54101 WP_015548346.1.68953 WP_015548346.1.69297 WP_015548346.1.724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]