SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384171171|ref|YP_005552548.1| from Arcobacter sp. L

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384171171|ref|YP_005552548.1|
Domain Number 1 Region: 12-302
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.88e-45
Family Methylenetetrahydrofolate reductase 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|384171171|ref|YP_005552548.1|
Sequence length 303
Comment 5,10-methylenetetrahydrofolate reductase [Arcobacter sp. L]
Sequence
MFETLIQKLQEDRFLTLETTPQHEPSMHNIIERIKKFKLQDRVDGFSCTDNPLAKLKYNA
LFASLKLQTEFNKPVIATMSMRDRNKIALQSDLMGANDFDVRAILALTGDPAKMSDQPHA
KGVFEANSLMLLKIIKSFNYGMDMSGHPFKIEPKQIFPFAVTNSYAKNFSTLEKKMNLKI
QNGAVGIISQPVFDIENAKKLLESFNIAKEGVEGDKKKAQLIFGVFPVTKLRTALFLSAQ
VPGIHVPQFWIDALETAHNISEEEEYKVGMQLSQDLFRDLNKLHPKIHLMTANRFDVANE
IIS
Download sequence
Identical sequences G2HSS0
WP_014473072.1.69177 gi|384171171|ref|YP_005552548.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]