SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384172267|ref|YP_005553644.1| from Arcobacter sp. L

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384172267|ref|YP_005553644.1|
Domain Number 1 Region: 1-274
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.99e-26
Family ABC transporter ATPase domain-like 0.0019
Further Details:      
 
Domain Number 2 Region: 1-51,615-788
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.5e-24
Family ABC transporter ATPase domain-like 0.0066
Further Details:      
 
Domain Number 3 Region: 359-458
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 0.000000654
Family Rad50 coiled-coil Zn hook 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384172267|ref|YP_005553644.1|
Sequence length 789
Comment chromosome segregation protein [Arcobacter sp. L]
Sequence
MILTKLKLENFKKYNSFEISFDLGLIGIIGKNGSGKSTIFEAILFALYGELRNKGDKEVV
RNANATSKDIVSVELDFEIGESIYKIIREFRGKTLSANAKLYKNEELITTGAKEVTTTIS
NLTKMSKDAFMHTLFASQKELTSLSNSKPEDRKKMIRKLLGLEKIDFVEKELVEKSRELK
REIDAFKEVLLSSEEITIKKENIVEQTAQKEEFLKEIDKQSLVLEELNQKVSTIKQELEL
FTKTKEQKQSLKARCELLTNTINSHQKAQEKLQNELNTLYTKQEELKGLQTIKQEYINLH
ETLKEQDKLKEYSLRKDGLLLEQKELREQYTKAKDSIKVLEFETKEHLELVEKEKELDKS
IEKYKQLLTNKELDEKRVVQEIAGEEKLIADIKKKIENITTLGRESNCPTCTRPLLDEYD
SVIFSLEQIVLNTQNTKIDTAKEQLANIKEEKEKLEEQQKAYIKEHFEISKKINLIENKK
RDLLALKEHFEKVTQKGVKNKEELAKLEIYSYDKNLHEELLLKQKELKTKYEYILSLETM
LKRVDTIKEELQTSIHNQDKYNLELLQKDLEYKAIYYDEVKHQEKSKEFDEVQKQKDSLI
SLINDLKVKIATIEGQIKTIQESLSNNETQLKKVQTKKDDLNDYEKIKINLAEFKTKLNS
KVAPRISDIASNMFAQITKGKYQHIEVSNDFDFYIYDEGKRYPIERFSGGEIDLANLVLR
IAISKTLSELSGANSVEFLAFDEVFGSQDDTRRMEILEAFHTIKEQYRQIFLISHEMEIK
EMFERVVEV
Download sequence
Identical sequences G2HW24
WP_014474163.1.69177 gi|384172267|ref|YP_005553644.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]