SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392383996|ref|YP_005033192.1| from Azospirillum brasilense Sp245

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392383996|ref|YP_005033192.1|
Domain Number 1 Region: 581-1041
Classification Level Classification E-value
Superfamily ALDH-like 3.8e-126
Family ALDH-like 0.000000326
Further Details:      
 
Domain Number 2 Region: 205-552
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 2.39e-118
Family Proline dehydrohenase domain of bifunctional PutA protein 0.000000000153
Further Details:      
 
Domain Number 3 Region: 36-204
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 1.19e-61
Family N-terminal domain of bifunctional PutA protein 0.00000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|392383996|ref|YP_005033192.1|
Sequence length 1242
Comment bifunctional protein putA [Includes: Proline dehydrogenase ; Delta-1-pyrroline-5-carboxylate dehydrogenase] [Azospirillum brasilense Sp245]
Sequence
MNSMTNPIDTRTAPPSAAPGEAAPFADFAPPIRPATELRAAITAAYRRPEPECLPFLFEQ
ASLPPGVITAAAATARKLITALRAKPRGRGVEGLIHEYSLSSQEGMALMCLAEALLRIPD
HATRDALIRDKIAGGDWQAHLGKGGSMFVNAATWGLLITGKLTSAGGEQALSSALTRLIA
RGGEPLIRRGVDFAMRMMGEQFVTGQTIQEALTNARTMEAEGFRYSYDMLGEAALTAEDA
ARYYADYVNAIHAIGTASAGRGVYEGPGISIKLSAIHPRYSRAQADRVMDELLPRVKALA
LLAKGYDIGLNIDAEEADRLELSLDLMESLCFDPDLAGWNGIGFVVQAYGKRCPYVIDFL
IDLARRSGHRLMIRLVKGAYWDSEIKRAQLDGLPDFPVYTRKVYTDVSYVACARKLLAAP
EAVFPQFATHNAQTLATIYEMAGSDFQVGKYEFQCLHGMGEPLYKEVVGPLKRPCRIYAP
VGTHETLLAYLVRRLLENGANSSFVNRIADPAVPVDELVADPVAVARAIAPTGAPHALIA
LPRNLYAPERANSAGIDLSDETELARLSAALSASAEMTWTAAPLLADGERAGQAQPVRNP
ADRRDVVGSVTEASEALVAEAFGHAVAAASAWAATPPEERAASLFRAADTMQERMPTLLG
LIVREAGKSLPNAIAEVREAIDFLRYYGAQVRDRFDNATHRPLGPVVCISPWNFPLAIFS
GQIAAALAAGNPVLAKPAEETPLIAAEAVRILHAAGIPAGALQLLPGAGEVGAALVGHEA
VRGVMFTGSTEVARLIQRQLAGRLLPDGAPIPLIAETGGQNAMIVDSSALAEQVVGDVIA
SAFDSAGQRCSALRILCLQEDVADRTLAMLKGAMRELRIGNPDRLAVDVGPVISEEARAT
IAAHIEAMRAKGRNVEFLPLPAETADGTFIAPTVIEIGGIHELEREVFGPVLHVVRFHRD
DLDALVDSINATGYGLTFGLHTRIDATIERVTGRIGAGNVYVNRNTIGAVVGVQPFGGHG
LSGTGPKAGGPLYLSRLLSRRPKGWLEFRGPDAARAAGLAYGEWLRAKGFTAEASRCAGY
VARSAIGGGAELNGPVGERNLYELHGRGRVLLLPQTRTGLLLQLGAVLATGNSAAVDAPP
DLAELLRGLPPALAARVRTTADWRDVGPLAAVLVEGDRERVTAINRRVADLPGPILLVQA
ATAEALAAGRGEGYDLDLLLNERSVSVNTAAAGGNASLVAMS
Download sequence
Identical sequences G8AUR6
WP_014242018.1.1190 gi|392383996|ref|YP_005033192.1|NC_016618 gi|392383996|ref|YP_005033192.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]