SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Mixos1|96896|fgenesh1_pm.12_#_106 from Mixia osmundae IAM 14324 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Mixos1|96896|fgenesh1_pm.12_#_106
Domain Number 1 Region: 30-407
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 5.02e-84
Family IF2B-like 0.000000857
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Mixos1|96896|fgenesh1_pm.12_#_106
Sequence length 419
Sequence
MSAKGANGKQDDKLRAIRMPDGDPAQFEGKGYVEIVDQLLLPHHIEWIKITSAEQAWHAI
RSMQIRGAPAIASLAALGLALDLLRLARHQGLADEHTYGKTGSPSSDDASARLIAETDRL
CDYLLSSRPTAVNLSAAIKLIRRVTQANKSEPAEQLVQAIVKTCKSVWQDDIARNVWIGM
NGARWLLETLEREGSLKPDESVNVLTVCNTGSLATSDYGTALGVITALHELGRLEHAFYA
QTAPYQQGARLTSLELLSLGIPATMVPDTAIAALLAGKKEGTPRIHCFVAGADRIAANGD
TANKISTYQISLLCHHVASEQARPKVIIAAPLTTIDMEMQDGTGIVIEQRPQEEAKTVSG
VLRDGQSSGKVVKVMFTPEAASVWNPAFDVTPAGLIDAISTEVRCLASQDGAFQLGTLS
Download sequence
Identical sequences G7E2E7
jgi|Mixos1|96896|fgenesh1_pm.12_#_106 XP_014565447.1.41237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]