SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|20088986|ref|NP_615061.1| from Methanosarcina acetivorans C2A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20088986|ref|NP_615061.1|
Domain Number 1 Region: 173-360
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 7.89e-58
Family Actin/HSP70 0.00000284
Further Details:      
 
Domain Number 2 Region: 11-167
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 7.67e-52
Family Actin/HSP70 0.0000141
Further Details:      
 
Domain Number 3 Region: 377-492
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), peptide-binding domain 7.85e-38
Family Heat shock protein 70kD (HSP70), peptide-binding domain 0.0000389
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|20088986|ref|NP_615061.1|
Sequence length 497
Comment molecular chaperone DnaK [Methanosarcina acetivorans C2A]
Sequence
MGDVPTANIRGKVLGIDLGTTNSCMAIIELGEPKVITNSEGKRLTPSVVGFSKRNELLVG
DLAKRQMISNPENTVQSIKRHMGKADFRVTLNGEQYTPHGISAKILQKLKHDAEKYLGDA
VEKAVITVPAYFNDSQRFATKKAGELAGLEVLRVINEPTVAALAYGLKDGVDNRKILVYD
LGGGTFDVSILKIKNGIFEVLATSGDTELGGDDFDGRIVEHLLAEFQKAEGTDISGIPQV
MQRVKEAAERCKIDLSTLTTANVNLPYIFESKTLDIDVTRDQFDRMTEDLVKKTLSIMKK
TLQDGKLSPSEIDEVIFVGGSARIPSVVKAVEDFMGKKSLQSINPDEVVAMGAAVQAGIL
GNEFLKSPREEVDAGNLVLLDVISLSLGFETVGDLMAPIILRNTTIPTRNSKIFTTHYDN
QRVVRGKILQGEERVASKNVALGMLVLDNIPSAPKGIPRIEVTFDIDANGIINATAKDLG
TGIMRSVTIERPEGLNE
Download sequence
Identical sequences Q8TUI0
WP_011020146.1.98848 gi|20088986|ref|NP_615061.1| 188937.MA0087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]