SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|20089637|ref|NP_615712.1| from Methanosarcina acetivorans C2A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20089637|ref|NP_615712.1|
Domain Number 1 Region: 117-303
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.44e-17
Family ATP-dependent protease Lon (La), catalytic domain 0.0019
Further Details:      
 
Domain Number 2 Region: 28-84
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0000275
Family Mitotic arrest deficient-like 1, Mad1 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|20089637|ref|NP_615712.1|
Sequence length 305
Comment hypothetical protein MA0752 [Methanosarcina acetivorans C2A]
Sequence
MKSKLLALILVLSLVANAYFVFFYQAPVEGEQVQEMQERINSLEKDNNRLETQVSQNNQS
LQSYASQLDFYRERVFELENNLQACPAGMEGFATLQAPAVFQNVELEKSGPFVREVISEE
GTLLNISTETRSGKGRVLVQTTPLMGVVFQDAANTAVFVAQQETGVSLSGSDVIFSIASD
QEIPGVDGSSAGALMTLLTISAINGTELNDSITLTGTIDDEGNVGEIGGVFEKATAAEAG
GKTLFLLPRENSELVTYKLVSRKIGGIDVVQRVPETVDAEEYIEENVGINVEYVDTIEDV
LEYET
Download sequence
Identical sequences Q8TSP3
WP_011020797.1.98848 188937.MA0752 gi|20089637|ref|NP_615712.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]