SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|20089818|ref|NP_615893.1| from Methanosarcina acetivorans C2A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20089818|ref|NP_615893.1|
Domain Number 1 Region: 26-174
Classification Level Classification E-value
Superfamily YutG-like 2.09e-35
Family YutG-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|20089818|ref|NP_615893.1|
Sequence length 183
Comment hypothetical protein MA0940 [Methanosarcina acetivorans C2A]
Sequence
MISMKLSDIEEKDLKEGQPEKVEGKATVDILDVLAEEGISVQDLADTALEMYVPHPGLET
REKAEALFKRELKFALSDPNLCLLIYSGILLEREGRAGNLPNLSKSSYEKDLSFIIADEV
LGNSIANYISGSKGTFEFVRYDKIKPGILANLGPFMDDVIGGLIGGVSSNMYSRGMAEFE
GKD
Download sequence
Identical sequences Q8TS65
188937.MA0940 gi|20089818|ref|NP_615893.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]