SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|20089985|ref|NP_616060.1| from Methanosarcina acetivorans C2A

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|20089985|ref|NP_616060.1|
Domain Number - Region: 160-228
Classification Level Classification E-value
Superfamily Cupredoxins 0.0189
Family Plastocyanin/azurin-like 0.039
Further Details:      
 
Domain Number - Region: 272-332
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0209
Family Collagen-binding domain 0.014
Further Details:      
 
Domain Number - Region: 35-98
Classification Level Classification E-value
Superfamily E set domains 0.0532
Family Arrestin/Vps26-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|20089985|ref|NP_616060.1|
Sequence length 477
Comment hypothetical protein MA1119 [Methanosarcina acetivorans C2A]
Sequence
MKKFSLLTILLLFSAFICLGAVTALGSTGDITSSSLEVSLTNQNPDSARPGEPVELTVSV
QNVGTKDAKDITVTVNPEYPFSKISGESLVKTVSYLNARQDDDEGAVLKFKLMTDTNASA
DTYDIDIVTTYKTGSGSSATTYTTTKTVTIEVRGKEYAQIVTIDKANIDIAKEETLEFIV
TNTGTSPLKNMVISWKDPDGVVLPVYSDNTKYIKYLDAGESVTITYSVMADVNADPGLYT
LDITLTLEDYDSNEQTINTTAGVFVGGETDFDVSFSESDEGEISLSVANVGNNIAYSVKV
SVPDQENYKVSGSSSTIVGNLEKGDYTITTFDVASTQGAVGAEGSTGGPGTAKASTEEGN
LTAASVENNPLLVQIEYTDAKGERITVDKEVELEITGGTMGPQTGGPGNSGGITSYLPYI
AVIILAGGAFVYRKKIGEKIRERKEKKSGNKKPEGNRITAASKKPEEQKYVNETSKD
Download sequence
Identical sequences Q8TRQ5
WP_011021144.1.98848 gi|20089985|ref|NP_616060.1| 188937.MA1119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]