SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|20090611|ref|NP_616686.1| from Methanosarcina acetivorans C2A

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|20090611|ref|NP_616686.1|
Domain Number - Region: 417-493
Classification Level Classification E-value
Superfamily E set domains 0.00567
Family E-set domains of sugar-utilizing enzymes 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|20090611|ref|NP_616686.1|
Sequence length 571
Comment hypothetical protein MA1760 [Methanosarcina acetivorans C2A]
Sequence
MSSESRNLNRFFLYFAGILIFFIYITPCLATYNFEGTPEQDELIEITSGTVKGGLYVDGG
EGLKKTPYVQEFNVPGDVVTWARVYVGVWGGTEEKTGTLDLTINGEEFESLDLEGKNDKG
DDEDQNPAIYCTGHGVYWIAYDVGTNISTGPVTVEAQTEGDIDGRVYGIILAAVYEDKEG
QSTKYWVEEGNINLHGKGWSETLASTHDEGYADFSGKVDTDKYNTANLAVVYLCGTPGLD
DSLYFNEEQLSDGENSNDIANSKSYFDFKFFDVLDLLEEDDNELKFQRDEEDYVHPVLAA
LTLGTGEEGTSDLIVSGLTVPLLYAGKDNTIKASIKNIGKDSAYGFQAALYADGEIVSTA
PVSSLSSGKSKTIEFNWKPAWDGEQALKVYVDYTNKKKETCEVNNWNSPFLAKVVDLTPP
ELEIDYPEDGARVDAGYLTVSGTIEDTNRNLTVDVNGQNALISGESWSASVPVVSGPNTI
VVSAVDGENNTGRELIVVEGKESSTDSKESSQSDLTVSSKAENETEPVNQSILGSQTREY
EKQAVLSPISEGIGFISAILFLRYRNRGKRL
Download sequence
Identical sequences Q8TPZ3
188937.MA1760 MvR187 NYSGXRC-10384s WP_011021763.1.98848 gi|20090611|ref|NP_616686.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]