SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|20090699|ref|NP_616774.1| from Methanosarcina acetivorans C2A

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|20090699|ref|NP_616774.1|
Domain Number - Region: 73-108
Classification Level Classification E-value
Superfamily E set domains 0.0734
Family Filamin repeat (rod domain) 0.01
Further Details:      
 
Domain Number - Region: 179-226
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.0981
Family Cna protein B-type domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|20090699|ref|NP_616774.1|
Sequence length 254
Comment hypothetical protein MA1849 [Methanosarcina acetivorans C2A]
Sequence
MMQKASQKEAFSPFFPEDLPDIVRGHEIWIEHSMQNVSPGDPVACVLCFGHNMKSDKAVQ
VKKVSPAIFSALGENRTVEVSTAEDHLLMQFIPTFAGYHTIGVEYDGGILNLPHPGLEGP
KYYQQYTKTILPVCQVRNCQVEWIYQTISDLIVGHELEIIPLGYRRYKVGEHILLKILYD
GHGLPEATVYGIHSGNQEKPLERTTDQKGMVEFELEKDGKWMFKVGHRDPEKGVKGLYDK
KVMTATFTIMNVGE
Download sequence
Identical sequences Q8TPQ7
188937.MA1849 WP_011021850.1.98848 gi|20090699|ref|NP_616774.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]