SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|20091552|ref|NP_617627.1| from Methanosarcina acetivorans C2A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20091552|ref|NP_617627.1|
Domain Number 1 Region: 30-276
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.08e-64
Family Alanine racemase-like, N-terminal domain 0.0000369
Further Details:      
 
Domain Number 2 Region: 249-390
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 3.98e-27
Family Eukaryotic ODC-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|20091552|ref|NP_617627.1|
Sequence length 390
Comment ornithine decarboxylase [Methanosarcina acetivorans C2A]
Sequence
MRKESYEFPLEDFIPREDFNKIKKFSRDKETPFLVIDLQKIERSYEELVEHMPFAKIHYA
VKANPMDRVVLALKDKGSNFDVATIYELDQVLRLGVEPERISYGNTIKKEKDIAYAYEKG
VRLFVTDSESDLKKLSREAPGSRVFFRILTESDGADWPLSRKFGSHPDLIYKLILKAEKL
GLEPYGLSFHVGSQQRDIGQWDNAISKCKYLFEAAAEKGIQLKMINLGGGFPAKYQAQAN
DLETYAREIRRFLHDDFGEELPEILIEPGRSLVADAGIIVSEVVMISKKARFNQYKWVYL
DIGKFGGLIETLDECIKYPIFCDKKGCAEEVILAGPTCDSMDILYEHHKYSFPHTMREGN
RAYIFTTGAYTQSYCSVNFNGFPPLKAYLI
Download sequence
Identical sequences Q8TMD1
188937.MA2728 WP_011022687.1.98848 gi|20091552|ref|NP_617627.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]