SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|20091652|ref|NP_617727.1| from Methanosarcina acetivorans C2A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20091652|ref|NP_617727.1|
Domain Number 1 Region: 1-241
Classification Level Classification E-value
Superfamily NIF3 (NGG1p interacting factor 3)-like 1.01e-57
Family NIF3 (NGG1p interacting factor 3)-like 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|20091652|ref|NP_617727.1|
Sequence length 298
Comment hypothetical protein MA2828 [Methanosarcina acetivorans C2A]
Sequence
MELKKIVQILEEIAPPELADDFDKGRIGLILGLESDVKKIAIALDANFYVLKKAAKMKAD
MLITHHTLIFHPVNIISKSLADSLRVALENGISLYSMHTNYDRAEEGINDILAARLGLKN
IRSPEIGRIGEIEPCSSTELATYVSDCLQTPVIYAGEKEEIRKVMVIGGSGFRNEYLELA
RENRVDAFISSELKHDILRAYEDLCLIDASHYATENPGMEALCPRLRSLTGIEVEFIDQP
SGLRTVNCRPKNEEKEPCNQEETGKDSLELMLEKQSRNQIRSDYRRSLGNEYGRRYLE
Download sequence
Identical sequences Q8TM42
WP_011022780.1.98848 gi|20091652|ref|NP_617727.1| 188937.MA2828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]