SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|20092627|ref|NP_618702.1| from Methanosarcina acetivorans C2A

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|20092627|ref|NP_618702.1|
Domain Number - Region: 11-40
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.00641
Family Mitotic arrest deficient-like 1, Mad1 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|20092627|ref|NP_618702.1|
Sequence length 114
Comment hypothetical protein MA3831 [Methanosarcina acetivorans C2A]
Sequence
MPCDNSKYQSSQVPDQIEKLRKELERLKGELRVLDGRHENTHTGPESFFLPWDFFLGPEK
YLPQFLREGWQEVQKIVRICSSELAQLTKKVHDWEICCSRNESNILLEECFWIV
Download sequence
Identical sequences Q8TJF4
188937.MA3831 gi|20092627|ref|NP_618702.1| WP_011023730.1.98848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]