SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|20092766|ref|NP_618841.1| from Methanosarcina acetivorans C2A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20092766|ref|NP_618841.1|
Domain Number 1 Region: 9-441
Classification Level Classification E-value
Superfamily L-aspartase-like 1.29e-123
Family L-aspartase/fumarase 0.0000000565
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|20092766|ref|NP_618841.1|
Sequence length 451
Comment adenylosuccinate lyase [Methanosarcina acetivorans C2A]
Sequence
MIDVAIHPIEYRYGTAEMKYVWSQENRLAKILQTEAALALAEADMGLIPAEAAEIISECV
PSVKAERVDEIEAEIHHDMMAVVVAISEKCREDAGKWVHFGATSNDILDTATALQIKDAI
DLLEDKLKILLRVLVNQAEAHKNTVCCGRTHGQIGVPTTYGLRFAIWASEISRHLDRLYE
LTPRATVGQMTGAVGTQAAFGKSGILIQKLTMQHLGIGAVDVSNQIIQRDRHAEFVMWMA
NTVTTLDKIGIEIRNLQRSEIAEIEESFGKKQVGSSTMPHKRNPIKSEQICGLARIVRAM
VEPELLNNTLWDERDLTNSSCERVVFPEACVLTDHILKLGIRVLENLRFYPENIRRNLDL
LRGLNMGEAVMIELAKRGVGRQEAHELVRTSAMEAHETGQHFKQVLLDTPSVSRYLSVED
IEKLVNPDKYIGTAVEQVEALVVRLREAYSL
Download sequence
Identical sequences Q8TJ18
188937.MA3971 gi|20092766|ref|NP_618841.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]