SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|20092807|ref|NP_618882.1| from Methanosarcina acetivorans C2A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20092807|ref|NP_618882.1|
Domain Number 1 Region: 206-538
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 2.71e-107
Family AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC 0.0000112
Further Details:      
 
Domain Number 2 Region: 2-192
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 5.1e-68
Family Inosicase 0.00000457
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|20092807|ref|NP_618882.1|
Sequence length 538
Comment phosphoribosylaminoimidazolecarboxamide formyltransferase [Methanosarcina acetivorans C2A]
Sequence
MVKRALLSVSDKTGITEFARGLEALGVKIISTGGTAKILRDAGIEVTDVSEVTGYPEMMG
GRVKTLHPRIHGGLLCLRESKEQMEEAEKEDISLIDLVAVNLYPFEITISKEGVELEEAI
ENIDIGGPTLLRSAAKNYRSVTVISNPSDYGHVLKELRSSGIISDKTRANLAVKAFRHTA
DYDAAIDTYLSRTLLGEEVLRLKFTDGVKLRYGENWHQSACFYKDPGIEGPSLAKAVQLH
GKELSYNNYVDADNALQTVKELGNASPAVAIVKHNNPCGLATGDTLLQALQAAWDGDPIS
AYGSIICTNETFDLEAATFLNGKFIEIILAPDFKPDALEYLKNKSENLRLLKLPELREVF
GTEYTYKYVIGGMLKQSRDIGIYDKWESVTEVSYPEGKRTLSEFCLKACKATKSNAVILA
HEYEPGYFMVLGMGAGQPNRVDSIRKLAATKAVENLKVIYEREQPAVAFEEYCQKILSEC
VMASDAFFPFDDSVVHAAENNIRYIVSPGGSIRDNEVIATANRLGIAMVFTGMRHFLH
Download sequence
Identical sequences Q8TIX7
gi|20092807|ref|NP_618882.1| 188937.MA4012 WP_011023907.1.98848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]