SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|20093076|ref|NP_619151.1| from Methanosarcina acetivorans C2A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20093076|ref|NP_619151.1|
Domain Number 1 Region: 21-337,385-417
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 9.55e-44
Family Quinoprotein alcohol dehydrogenase-like 0.0013
Further Details:      
 
Domain Number 2 Region: 1473-1835
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.93e-41
Family Quinoprotein alcohol dehydrogenase-like 0.007
Further Details:      
 
Domain Number 3 Region: 1872-1952
Classification Level Classification E-value
Superfamily PKD domain 2.22e-30
Family PKD domain 0.00023
Further Details:      
 
Domain Number 4 Region: 922-1003
Classification Level Classification E-value
Superfamily PKD domain 9.68e-30
Family PKD domain 0.00036
Further Details:      
 
Domain Number 5 Region: 1005-1252
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 8.16e-29
Family Quinoprotein alcohol dehydrogenase-like 0.0043
Further Details:      
 
Domain Number 6 Region: 832-918
Classification Level Classification E-value
Superfamily PKD domain 5.62e-27
Family PKD domain 0.00036
Further Details:      
 
Domain Number 7 Region: 421-507
Classification Level Classification E-value
Superfamily PKD domain 1.96e-25
Family PKD domain 0.00032
Further Details:      
 
Domain Number 8 Region: 1363-1467
Classification Level Classification E-value
Superfamily PKD domain 5.62e-22
Family PKD domain 0.00035
Further Details:      
 
Domain Number 9 Region: 516-598
Classification Level Classification E-value
Superfamily PKD domain 2.62e-21
Family PKD domain 0.00026
Further Details:      
 
Domain Number 10 Region: 1190-1360
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.0000222
Family Galactose oxidase, central domain 0.036
Further Details:      
 
Weak hits

Sequence:  gi|20093076|ref|NP_619151.1|
Domain Number - Region: 2111-2162
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00106
Family Type I dockerin domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|20093076|ref|NP_619151.1|
Sequence length 2165
Comment cell surface protein [Methanosarcina acetivorans C2A]
Sequence
MNKHTLKIFLICVILFLVAAAQPVLGSDWAQFQKDIHNTGVTADRAPITDPTNCSLSWNY
SMGGNIDVTPVVAGDMTYVVASNNHLCAFNRTTGTLLWEESTSGGGFLLGNLAVGNGIVF
VPTVDGKIFAFDAETGSPKWNKTLSSKQLDTPILYYDGKIYFGEAMGGRKYYCLDETGNE
VWNRTATTQNSGQGSYYWAGAAVIGDSLVYGDDDGHLVSVNKDTGTDIAEIDVSEEFGIT
CKEIRSSVLYVEELNRIYFTSKGGYCYALGFNVEDGTFNTSEKYIANIGYSTSTPAYYNG
RVYVGAGGMYGGGSGISCLDENLTDEIWHYAAGAVQSSPAISTYYDDGDGEAYIYFTVNS
ATGGVFCLKDYTGCTNPELAWSYADASKTAYTLAGAVISDGWIYYGTDKRYLFGFTTEKE
QTPSIPVANFSANPLSGDSPLTVQFTDLSTGDGINVWAWDFNNDGIVDSTEQNPSHTYTP
AGNYTVNLTVENANGSDFEVKTDHITVTDGSSGGDAPVADFTANVTSGVAPLTINFTDQS
TNAESWAWDFNGDGIVDSTEQNPQYTYYPGNYTVNLAVNNSAGSDTESKEDYIWVIGPYS
TAVANENPGAPDPGIPQYIGPDGDGKHDATNYPNNYKNPIFVASYTSIVDYSPSTGREQN
SYRSLGDLYQEEIDAGASPGEITVWFEAPICNGEGADFAAYENGFIISDTNLIFAELGYL
EVSTDGEHFVRFPSVSYTPEAVGGYGGVDARNVYNLVGKHVHMYGDYWGTPFNLDDLADD
PGVLNGSVDLNEINYVKIVDIPGTGYYKDSLGNPIYDAWPTYGTGGLEFGGVDIIHCRPA
ANFTADETTGSGSLTVQFNDTSTGGPTSWFWDFGDGNTSTEQNPVHEYTTNGTYTVSLKA
INEFGNDSEVREGYITVEYKDPRSPVVDFTADPVSGAFPLTVNFTDASTGNPTGWFWDFG
DGNTSTEQNPVHVYADSGKYTVKLTATNEFGSSYLVKTDYIEPYGILADTPWPKFRMDAR
NSGISPYTGPQTNNTIWNITTDASFSSSSSFSIGSDGTIYFGGGYSDYNVYALNPDGTLK
WNYTVGKSIYGTPTISSDGTIYFGSSDKNCYALNPDGTLKWSYTTDSTLAASPAIGSDGT
IYFGGQSGHGTDGTVYAMNPDGTLKWSYTDSDAAIASVSPAIGSDETIYVPFQDGTVYAL
NPDGTEKWNFSTGSQIYSSAVLDSEDVLYIGTRGAKVFAINPDGTEKWNYTAGGSLSFFY
MFDYSSPIVGTDGTVYIGTYGWNDFFALNPNGTLKWSSSDIGSSFSGSPVMGADGTIYIG
SNDKKVSAINPNGTIKWTYTTEASVGCTPAIGSDGTLYIGTDTVYDTHGDFLAGGVLYAF
RDPADLPVASFTSDTTSDEVPLSVSFTDTSERAESWAWDFDSDGVVDSTEQSPTYTYISP
GNYTVTLTVSNTGGSDAVIKEDYINVLEAPASSSADEDTWYQFRKTAEHTGYTTSDAPDT
NTLLWRSARLTDDFTLVPSSSVAIADGKVFANAIIGSVDEEGNPEEGAIGQLVAFSMYNG
RKYWNTTIAVPEWGSWSSPAYDNGFVFTSTGANTTCINATTGAIEWTFTNPSGRASCNGG
PVIAEGKVLCSDWDGLHYYCLDETTGTELWNYTVDSSDSYTQGTPAVSNGTIILTSWDDI
YCLDMDGNLLWAKPNPSSSGSICGSPSIAGDMFYLTTYDFGSDDKPALFAFDLENGTEIW
NATIQRTDSTPAIADGYLYVCGGCTGYSESQTYCFDALNGTLIWSTPKADQGIGDWTCSI
AVADGKVFVGKSAGSSFGHKGLYALNAETGDEIWYSDSAGDSPAIADDTVFSIGLDQEDV
AYLYAFKDEESGMPVADFSADITSGVTPLTVNFTDQSTGTPTSWFWEFGDGGNSTEQNPS
HIYNAPGTYTVNLTVENAGGTDFELKSDYIEVSEASGSTVTLYFDPESASVAENESTEIN
LVASNFPAGLSGYNLTVALDDPDVAEIVDIEYPTWALITENSSLPATSIYMKTVDLEDAI
QEGAADVVLATLTVSGKEKGSANLSIGVKRLEEDSGDSIEPALLAGTIEVTLLSPLPDQE
YAPKDLNGDGLYEDLTGNGEFSFVDIVAYFHNMDWIEENMPVEYFDFNGNGRIDFDDVVD
MFAMI
Download sequence
Identical sequences Q8TI69
188937.MA4287 gi|20093076|ref|NP_619151.1| MvR140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]