SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EmuJ_000211200.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EmuJ_000211200.1
Domain Number 1 Region: 40-343
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 6.2e-75
Family Protein serine/threonine phosphatase 0.00000581
Further Details:      
 
Domain Number 2 Region: 461-493,549-612
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000211
Family Polcalcin 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EmuJ_000211200.1
Sequence length 618
Sequence
MRSQSKSSFSKNLERRLQKVAIAGKGDARWKNSTIRFHESQWHSRFNNDYIQSLIEFQKQ
GKILDSELVMEVFEEATLFLQALPNIQRASTTLSQRITICGDLHGQVEDLALIFQANGLP
DVFNPYVFNGDFVDRGNNSIEVLVILLSCLLAHPSAVFLNRGNHEDPILNKRYGFADEVR
SKYPKQYKKILNQAELLFCAIPLCTILDDVILVCHGGISRTTDLTKVTKLDRKLFFSVLQ
PPLEGEKAVSIDDWRQVLDLLWSDPQSAPGCKPNIKRGGGSHFGPDITASLLNHLKVGIL
IRSHECCPNGWKMDHNNQVLTVFSASNYYGTDSNLGAFIQLSSRRVVGAASAATRISIME
PVKCELDDLPMAQASAMGNESATIAASTNTSARISYTRVMTPPENGEETANRHKQIVEIL
LAPRLVMFRTGRSSKHQSLLGKRNLNDAAYRMLLRRILSRRETIVAALCTYDPQRTGEVK
ITQWCTVMLKHAGQSLPWRILRYSLVKSSPTRPKTHVLYMSMFDPKHEIFSESTKRKFTS
ENYADLDDLVSIFKQFDNDDNGFVSVEKFKEKCKKLYTDKGFPSNDSTINRLAMLLDFNS
DGIIDFNEFIEGSRLVRT
Download sequence
Identical sequences A0A087W102
EmuJ_000211200.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]