SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EmuJ_000522800.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EmuJ_000522800.1
Domain Number 1 Region: 25-303
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 8.96e-117
Family Protein serine/threonine phosphatase 0.000000000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EmuJ_000522800.1
Sequence length 323
Sequence
MAGESDLNVDEIISALLEVRGPRISTAVNLKEEDIKALCAKSREIFLSQPILLELEAPLK
ICGDIHGQYTDLMRLFEYGGFPPDANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNVKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDL
QTMEQIRRVLRPTDVPDTGLLCDILWADPDKDTRGWGENDRGVSFVFGVDVVEKFLHRHD
LDLICRAHQVVEDGYEFFAQRRLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSE
KKSKYQYLGVNSARQGGFARPTM
Download sequence
Identical sequences A0A068Y706
EmuJ_000522800.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]