SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EmuJ_000638400.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EmuJ_000638400.1
Domain Number 1 Region: 412-804
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.65e-108
Family Ankyrin repeat 0.0000000114
Further Details:      
 
Domain Number 2 Region: 173-430
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.38e-73
Family Ankyrin repeat 0.00000387
Further Details:      
 
Domain Number 3 Region: 22-254
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.2e-64
Family Ankyrin repeat 0.0000114
Further Details:      
 
Domain Number 4 Region: 1522-1603
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000262
Family DEATH domain, DD 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EmuJ_000638400.1
Sequence length 1925
Sequence
MTKGTDPQHGSTKRGGESGENLLRAARAGDLKKVLDLINSGVNINATNPTGLTALHLAAK
EGHTAVVKELILHGADVNATSKKGNTPLHIASLAGHLGVVRALLDANANPNCQSVVGFTP
LYMAAQENHLDVVILLLNKGANQSLTTEDGFTPLAVALQQGHDRVVATLLERDTRSRGGL
PALHVAARKDDVNAANLLLMSPDANVNHQSQPGFTALHIAAHYGSTNVGALLIQRGADVN
FQAKNNITPLHVAAKWGRVAMVKLLLDNGASVDGRTRDGLTPLHCAARSGYNNVCTMLID
SGCNPSAKTRNGLTPLHMAAQGNHDEVTCNLISRGASLQATTGDFLNPLHVAAHCGNLKV
ARILVEKSCDMNARALNGFTPLHIACKKNKIPVVELLLNRGAQISSTTEAGLTPLHVAAF
IGSPDLVRLLLEHGASVEQTTMRGETPLHLGARSCNLEVAELLLTHGAAVDAKAKDEQTP
LHIATLCGSADMVLLLLKFGANPNMTTRDAYTALHIAAKDGRADIVQCLLASGADPDART
RRGFCPLHLAAKRGRAEAARTLLQVMRPELVNAVGRNGLTPLHMAAHYNHVPLVQLLLEF
GAEADRPAGNGYTALHIAAKRNHQDLAALLLANDRDPIRSTNRESRCGFTPLHLAALEGN
SDMVGLLLLNGADAEHKAKNGVTPMHLAALEDHVTVAQQLVHEGAQATAVTQVGYTPLHT
ACYAGRLNMVRFLVALATSDINAATNTGFTPLHLAAQQGHSDIVYLLLEHGADPNARNSQ
GLTAAQIARHQHYPTIFDTLRTVTTVITNWDDVMETYDTEILLDLPEIVTTAKEAAEAVE
SDEEGMALSQKVDRTTAYPSQYQAEYVKTSSQAANTLHPSESAYENDRIWGEMEYLSQPL
RNRQPTIGSGDEQVLHETSVVPQHNTSLSATLTSDLHMGESSRVLAGPGDNLDAEWEMET
EPVMSTSKKPLAGGFLVSFLVDARGGLLESKRYPGMRFIIPPNASVGPLRIICRLLRYPP
YAIQPPLNDGEGLACRLIEVGPVGVRFNAPILIEVPYCASLRSSQREIVVLRSENGEIWK
EHPVDPTDQAVQDSLGEYFVDATPSTELRRRRVHRILTSTTPQYFALITRTRQDLVIVGP
DGYVLTSSVDPQVKVTFPRGALQKKIRVGLQVQTVDPGLVAACLGSPRIAVSPIVTIEPR
RRKFHRPIVVFIPLPTVAGKGAQQQQKGQAPPDLSTVRLLCSITGGTAPAIWEDITGSSP
FSLQKDCVSFTTTVSARLWLIDCPNLSEVSEMAMRVYSEATAVPYLGRFIVYARRHHPEE
ARIRCVCLTDDSEQKTLECQEGFEVVARSGEGGTSGGVFAQPARWLETAGNLVPVAASHA
ASTTDITTVVDQLRFPSIRAFEENRLNVLLRIKDLNSPPAGHLAFMPQQRQPGGVSVNPL
CVLDLLLPRMVASSISETEVSARRHSSQKGTATAAIGTGATAASLENFFNNNVKYSSSDE
DCGSVGHRYGKCRVVESIARSDLDVKKVADNLGADWVYLAPYLGLSAQDVSDIRANGVDS
DYKIALTCLTLWQERAGPQATGTALARALKQAGREDVLRQSMQNISLVQTDPELSHALRS
LEAADKAPTVEQVEGEKAKEVITEVEVEAKPHQGVIEPAIVDDGVLEMAISPPTEALPQH
KETSSEERKAALEALAVQLNEDSFELPSAAGPADTDDTDGVSEKEVVAEAVKRNVQLESA
VPAFLLEEMRQQEDTTSTLDAAPRNEPFDIDVDTASTTAVVGVEGSTLISTPTDANARKP
SVHAELTMSGLTQPTLEWTPEMASEDGKSLWIAPGDAKESSTNGDLEAKVEAEVEQAVAM
ESVEAQGDVIIQPVAVPMCGVSEATWGRAQSPPPSPDFDIPLIVPTVVERLGEREDTWGK
PQQLD
Download sequence
Identical sequences A0A068Y9K1
EmuJ_000638400.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]