SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EmuJ_001008700.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EmuJ_001008700.1
Domain Number 1 Region: 3-294
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.25e-114
Family Protein serine/threonine phosphatase 0.0000000059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EmuJ_001008700.1
Sequence length 307
Sequence
MASMSDLDRQIALLRECKLISESEVKALCAKAREILIEESNVQYVDSPVTVCGDIHGQFF
DLIELFKVGGEVPDTNYLFLGDFVDRGYYSVETFLLLLALKVRYPDRITLIRGNHESRQI
TTAYGFYEECLRKYGSPLVWRQCTEIFDYLCLSAIIDDRIFCVHGGLSPHIERLDQIRVI
DRKQEVPHEGPMCDLLWSDPEDSAGWNVSPRGAGFLFGADTVQQFNHVNKLDLICRAHQL
VMEGRRYHFNETVLTIWSAPNYCYRCGNVAAILRLDEYLNRDFAFFEAASQNNRNFPARK
PVPDYFL
Download sequence
Identical sequences A0A068YCT5 U6J6M1
EmuJ_001008700.1 EgrG_001008700.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]