SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EmuJ_001102500.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EmuJ_001102500.1
Domain Number 1 Region: 158-481
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.47e-101
Family Protein serine/threonine phosphatase 0.00000000326
Further Details:      
 
Domain Number 2 Region: 9-134
Classification Level Classification E-value
Superfamily TPR-like 6.64e-27
Family Tetratricopeptide repeat (TPR) 0.0000352
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EmuJ_001102500.1
Sequence length 486
Sequence
MAVEVSLEAERFKIQANEYFSKGKYSDAIDLYTKAINVQEKAVYYANRSFAYLKTELFGA
AATDASKAIELDPSYIKGYYRRASANMAMGHYNLALKDFETVKKKHPGDKDACSKHLECF
RKARMRAFAQAISHEERRSPLETYDPSQVVVESSYNGPHLPQDEEGDYTVTVEFMNALIE
TFKAQGKLHRKYAMVLVCKFYDHIRQLPSLVNIDVPDGTKFTVCGDIHGQFYDLINIFSL
NGMPSPENPYLFNGDFVDRGSFSVECIFTLIGFKLLYPDHFFMSRGNHESENMNQMYGFE
NEVRSKYNNQMAEIFTEVFNWLPLAHLINGRVLTMHGGLFSSDNVSLDDLRSIHRNCQPP
DSGLMCEILWSDPMEARGRAPSKRGVGCQFGPDVTHSFCDSNGLDYIIRSHEVKEQGYEV
AHDGRCVTVFSAPNYCDITQNLGAFITLRSSHEAGGMKPEFTTFKEAPHPRVRPMAYANS
LLANLL
Download sequence
Identical sequences A0A068YJ16
EmuJ_001102500.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]