SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EmuJ_001106500.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EmuJ_001106500.1
Domain Number 1 Region: 11-296
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 2.89e-117
Family Protein serine/threonine phosphatase 0.000000000108
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EmuJ_001106500.1
Sequence length 311
Sequence
MTGDSRSEVKELDAWIEQLYNCQQLSEAHVKSLCDKAKEILTKESNVQNVSSPVTVCGDV
HGQFHDMMELFRIGGKAPDTNYLFMGDYVDRGYCSVETVTLLVALKVRFRDRITVLRGNH
ESRQITQVYGFYDECLRKYGNSNVWKYFTDLFDYLPLTALVDNSIFCLHGGLSPSIDTLD
HIRALDRIQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISEQFNHSNSLSLIS
RAHQLVMEGFNWCHERNVVTIFSAPNYCYRCGNQAAIMELDDNLKYTFLQFDPAPRRGEP
HVSRRTPDYFL
Download sequence
Identical sequences A0A068YEU6 A0A0R3UFG0
EmuJ_001106500.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]