SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374291321|ref|YP_005038356.1| from Azospirillum lipoferum 4B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374291321|ref|YP_005038356.1|
Domain Number 1 Region: 7-288
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 7.06e-101
Family Methylenetetrahydrofolate reductase 0.0000000337
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374291321|ref|YP_005038356.1|
Sequence length 301
Comment 5,10-methylenetetrahydrofolate reductase [Azospirillum lipoferum 4B]
Sequence
MTAPTSAQPSISFEFFPPKSEKMEQSLWQSIRRLAPLSPDFVSVTYGAGGSTRERTHATV
CRIQAETGIPAAAHFTCVGATRDEIDAIARTYWDAGIRHLVALRGDPPETAGGVGGRYEP
YPGGYAYAADLVAGMKRIADFEISVAAYPEAHPEAPSAQFDLDNLKRKVDAGATRAITQF
FFDNDVYFRFLDRCAAAGIHVPIVPGILPITNFARAVEFAGKCGASMPAKLAETFEGLDD
DPETRQLVAATVAAEQCQELQARGVHDFHFYTLNRSDLTIAICRMLGVKAKAAAAVAPVA
G
Download sequence
Identical sequences G7Z9J4
gi|374291321|ref|YP_005038356.1| WP_014247148.1.44154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]