SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374293975|ref|YP_005040998.1| from Azospirillum lipoferum 4B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374293975|ref|YP_005040998.1|
Domain Number 1 Region: 25-217
Classification Level Classification E-value
Superfamily Cytochrome c 4.45e-70
Family Cytochrome bc1 domain 0.00000252
Further Details:      
 
Domain Number 2 Region: 218-252
Classification Level Classification E-value
Superfamily Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor 0.00000562
Family Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374293975|ref|YP_005040998.1|
Sequence length 253
Comment Ubiquinol-cytochrome c reductase, Cytochrome c1 (heme protein) [Azospirillum lipoferum 4B]
Sequence
MRALKTAILSAALALGIAGAAQASEAVHIPKQNWPHSGIFGTIDKASAQRGFQIYKEVCA
ACHSMRLVPIRTLAGIGFSEDELKAIAAGYEVQAGPNDAGEMFMRPAIPADRFPSPFANE
QAARASNNGALPPDLSLMAKARVGGEDYLYAFLTGFEEPPADVKLMDGMSYNKVFPGHQV
GMPNILQPDGVTFADGTKATVEQQAHDVATFLTFAAEPHLDARKQMGVKVILFLLVLAGL
MYATKRKLWSTLH
Download sequence
Identical sequences G7ZER5
gi|374293975|ref|YP_005040998.1| gi|374293975|ref|YP_005040998.1|NC_016623 WP_014249759.1.44154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]