SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374294361|ref|YP_005041386.1| from Azospirillum lipoferum 4B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374294361|ref|YP_005041386.1|
Domain Number 1 Region: 588-1050
Classification Level Classification E-value
Superfamily ALDH-like 1.26e-125
Family ALDH-like 0.000000334
Further Details:      
 
Domain Number 2 Region: 210-559
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 4.71e-118
Family Proline dehydrohenase domain of bifunctional PutA protein 0.000000000269
Further Details:      
 
Domain Number 3 Region: 40-209
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 3.66e-61
Family N-terminal domain of bifunctional PutA protein 0.00000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374294361|ref|YP_005041386.1|
Sequence length 1244
Comment bifunctional proline dehydrogenase/delta-1-pyrroline-5-carboxylate dehydrogenase [Azospirillum lipoferum 4B]
Sequence
MNQMTDPSVAPASEPSFASGVLSSGTGPFAAFAPVVRPAGPLRQAITAAYRRPEPDCVAW
LVEQATLPDEVTAAAAQTARSLIAALRAKPQGRGVEGLIHEYSLSSQEGVALMCLAEALL
RIPDRATRDALIRDKISGGDWRAHLGNSPSLFVNAATWGLLVTGKVTGVLGGEQALSSAL
TKLILRGGEPLIRRGVDFAMRMMGEQFVTGQTIDEALSNSRKMEAEGFRYSYDMLGEAAT
TAADADRYHADYEKAIHAIGKASAGRGIYDGPGISIKLSALHPRYSRAQAGRVMAELLPR
VTELARLARRYDIGLNIDAEEADRLELSLDLLESLCFDPDLKGWNGIGFVVQAYGKRCPY
VIDFIVDLARRSGHRLMVRLVKGAYWDSEIKRAQVDGLEDFPVYTRKLHTDVSYVACARR
LLGAPEAVFPQFATHNAQTLATIYRMAEQMNGEFQVGQYEFQCLHGMGEPLYKEVVGPLQ
RPCRVYAPVGTHETLLAYLVRRLLENGANSSFVNRIADKSVSIDDLVADPVAQARAALPM
GEKNPLIALPKDLFGAERANSAGLDLSNETTLAELSTALRDSAAVAWTAAPLLADGERRG
AAQPVLNPADHRDVVGHCVEATPADIADAFLFAEAAAPVWAATPPAERAACLFRAADEMQ
ARMPTLLGLIIREAGKSTANAIAEVREAIDFLRYYGARVRDGFGNDTHLPLGPVVCISPW
NFPLAIFSGQVAAALAAGNPVLAKPAEETPLVAAEAVRILHAAGVPAGAVQLLPGAGEVG
AALVGHAGTRAVMFTGSTEVARLIQHQLAERLSPDGAPIPLIAETGGQNAMIVDSSALAE
QVVGDVIASAFDSAGQRCSALRILCLQEDVADRTLTMLKGAMRELRIGSPDRLAVDVGPV
ISAEARDGIARHIEAMRAKGRRVESLPLPAETANGTFVAPTIIEIDGIADLEREVFGPVL
HVLRFRRDDLDRLVDAINGTGYGLTFGLHTRIDATIDRVTSRIEAGNLYVNRNTIGAVVG
VQPFGGHGLSGTGPKAGGPLYLSRLLSVRPCLDLGLRGSDAVRAPAHALAGWLADQGKAE
IATDIRTLAKHSPVGGSVELAGPVGESNVYSLIPRGRILLLPQTEDGLYRLLGAALATGN
EVVVDGDSAVTAGLKSLPAELSSRVRVSANWLSFGALAGALVEGDAFRLLAANRRIAELP
GPIVLTQGVPVGGEGVEIAWLMNERSLSTNTTAAGGNASLVAMS
Download sequence
Identical sequences G7ZID6
gi|374294361|ref|YP_005041386.1|NC_016624 gi|374294361|ref|YP_005041386.1| WP_014250138.1.44154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]