SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374292354|ref|YP_005039389.1| from Azospirillum lipoferum 4B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374292354|ref|YP_005039389.1|
Domain Number 1 Region: 21-170
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00000000000000461
Family N-acetyl transferase, NAT 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374292354|ref|YP_005039389.1|
Sequence length 186
Comment putative GCN5-related N-acetyltransferase [Azospirillum lipoferum 4B]
Sequence
MRTAEAMTAGGGIRLERLTDLPDREAALAALEEIFFASTTRTEFASDADRAAFLATWTGW
YVADAPRDIWMAVAGDGLVVGYLTGCKDSAGTPELARRIPKYEVFADHFAAYPAHFHVNV
RPGWREHGLGRRLVDRFAEDCRGDGLPGVHLVTAVFARNVEFYRRAGFTDACQRGPLLLL
GRNLKT
Download sequence
Identical sequences G7Z1P0
gi|374292354|ref|YP_005039389.1| WP_014248163.1.44154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]