SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374998463|ref|YP_004973962.1| from Azospirillum lipoferum 4B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374998463|ref|YP_004973962.1|
Domain Number 1 Region: 14-171,211-296
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.000000000000842
Family EF1021-like 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374998463|ref|YP_004973962.1|
Sequence length 368
Comment hypothetical protein AZOLI_p10548 [Azospirillum lipoferum 4B]
Sequence
MSVIDWKQRGVGRYEPDDRAALDAFQRAHFGAEAIQLCPDHFHWLFEEPPEREHEGPQLW
LCKRNGAVVGQQGGIPFALKVGERNRRASWAIDLMVAPEWRLRGVGPALSETHSSASDLA
VSLSMTEAAYKSYKRAGWLDLGNVPTYLRVIDPLRCLRVSPYGGGLAKLVARIGKPALAT
ASMGYGLSAKLLGVRLVEIDRFDYRVDDLWEAASPQHPVIARRDWAFLNWRFDTTPQADR
FRRFYVMRGETVLAYVVLRVDHWKGEPVGVICDYLARPGWLVAAFSLMTELARRQGMVAL
MCRTLNAQAARPLSMMGFLCLKNGLHTPTRMMVRPALDQPELAGPTGDPKNWFVTVADSD
MGFKGLGE
Download sequence
Identical sequences G7ZBM6
gi|374998463|ref|YP_004973962.1|NC_016585 WP_014188241.1.44154 gi|374998463|ref|YP_004973962.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]